PDB entry 2ghv

View 2ghv on RCSB PDB site
Description: Crystal structure of SARS spike protein receptor binding domain
Class: viral protein
Keywords: SARS, S protein, VIRAL PROTEIN
Deposited on 2006-03-27, released 2006-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.184
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Spike glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Gene: S
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ghvc1
  • Chain 'E':
    Compound: Spike glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Gene: S
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ghve_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ghvC (C:)
    madpnitnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatk
    lndlcfsnvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatst
    gnynykyrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqp
    yrvvvlsfellnapatvsglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ghvC (C:)
    tnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcf
    snvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyk
    yrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvl
    sfe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ghvE (E:)
    madpnitnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatk
    lndlcfsnvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatst
    gnynykyrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqp
    yrvvvlsfellnapatvsglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ghvE (E:)
    tnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcf
    snvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyk
    yrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvl
    sfe