PDB entry 2ghu

View 2ghu on RCSB PDB site
Description: Crystal structure of falcipain-2 from Plasmodium falciparum
Class: hydrolase
Keywords: papain-like cysteine protease, L-domain, R-domain, alpha helix, random coil, twisted antiparallel beta-sheet, HYDROLASE
Deposited on 2006-03-27, released 2006-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.231
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: falcipain 2
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ghua_
  • Chain 'B':
    Compound: falcipain 2
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ghub_
  • Chain 'C':
    Compound: falcipain 2
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ghuc_
  • Chain 'D':
    Compound: falcipain 2
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ghud_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ghuA (A:)
    qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn
    klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct
    ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg
    fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli
    e
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ghuB (B:)
    qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn
    klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct
    ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg
    fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli
    e
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ghuC (C:)
    qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn
    klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct
    ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg
    fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ghuC (C:)
    qmnyeevikkyrgnfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairknkl
    itlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrctek
    ygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvgfg
    mkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafiplie
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ghuD (D:)
    qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn
    klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct
    ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg
    fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli
    e