PDB entry 2ghl

View 2ghl on RCSB PDB site
Description: Mutant Mus Musculus P38 Kinase Domain in Complex with Inhibitor PG-874743
Class: Transferase
Keywords: MAP Kinase P38, P38, Transferase
Deposited on 2006-03-27, released 2006-04-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.22
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ghla_
  • Heterogens: LIB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ghlA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemagfva
    trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
    ellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
    hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ghlA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivltddhvq
    fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglaratrwyrapeimlnwm
    hynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarny
    iqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddep
    vadpydqsfesrdllidewksltydevisfvppp