PDB entry 2gh7

View 2gh7 on RCSB PDB site
Description: Epi-biotin complex with core streptavidin
Class: biotin binding protein
Keywords: protein/ligand interactions, streptavidin, biotin, biotin binding protein
Deposited on 2006-03-26, released 2006-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.144
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gh7a_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gh7b_
  • Heterogens: BTN, BTQ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gh7A (A:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gh7A (A:)
    eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
    gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gh7B (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gh7B (B:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp