PDB entry 2gh1

View 2gh1 on RCSB PDB site
Description: Crystal Structure of the putative SAM-dependent methyltransferase BC2162 from Bacillus cereus, Northeast Structural Genomics Target BcR20.
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-03-24, released 2006-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methyltransferase
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC2162, GeneID:1204511
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81E32 (Start-292)
      • modified residue (57)
      • modified residue (118)
      • modified residue (124)
      • modified residue (128)
      • modified residue (149)
      • modified residue (187)
      • modified residue (216)
      • modified residue (283)
    Domains in SCOPe 2.07: d2gh1a1
  • Chain 'B':
    Compound: Methyltransferase
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC2162, GeneID:1204511
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81E32 (Start-292)
      • modified residue (57)
      • modified residue (118)
      • modified residue (124)
      • modified residue (128)
      • modified residue (149)
      • modified residue (187)
      • modified residue (216)
      • modified residue (283)
    Domains in SCOPe 2.07: d2gh1b_
  • Heterogens: ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gh1A (A:)
    mletydwnnkltylkntrdlyynddyvsflvntvwkitkpvhivdygcgygylglvlmpl
    lpegskytgidsgetllaearelfrllpydseflegdateielndkydiaichafllhmt
    tpetmlqkmihsvkkggkiicfephwisnmasylldgekqsefiqlgvlqklfesdtqrn
    gkdgnigmkipiylselgvkniecrvsdkvnfldsnmhhndkndlyqslkeegiagdpgd
    kqqfverliargltydnalaqyeaelrffkalhlhsslvyapnmkitfgeieclehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gh1A (A:)
    ylkntrdlyynddyvsflvntvwkitkpvhivdygcgygylglvlmpllpegskytgids
    getllaearelfrllpydseflegdateielndkydiaichafllhmttpetmlqkmihs
    vkkggkiicfephwisnmasylldgekqsefiqlgvlqklfesdtqrngkdgnigmkipi
    ylselgvkniecrvsdkvnfldsnmhhndkndlyqslkeegiagdpgdkqqfverliarg
    ltydnalaqyeaelrffkalhlhsslvyapnmkitfgeiec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gh1B (B:)
    mletydwnnkltylkntrdlyynddyvsflvntvwkitkpvhivdygcgygylglvlmpl
    lpegskytgidsgetllaearelfrllpydseflegdateielndkydiaichafllhmt
    tpetmlqkmihsvkkggkiicfephwisnmasylldgekqsefiqlgvlqklfesdtqrn
    gkdgnigmkipiylselgvkniecrvsdkvnfldsnmhhndkndlyqslkeegiagdpgd
    kqqfverliargltydnalaqyeaelrffkalhlhsslvyapnmkitfgeieclehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gh1B (B:)
    ylkntrdlyynddyvsflvntvwkitkpvhivdygcgygylglvlmpllpegskytgids
    getllaearelfrllpydseflegdateielndkydiaichafllhmttpetmlqkmihs
    vkkggkiicfephwisnmasylldgekqsefiqlgvlqklfesdtqrngkdgnigmkipi
    ylselgvkniecrvsdkvnfldsnmhhndkndlyqslkeegiagdpgdkqqfverliarg
    ltydnalaqyeaelrffkalhlhsslvyapnmkitfgeiec