PDB entry 2gh0

View 2gh0 on RCSB PDB site
Description: Growth factor/receptor complex
Class: hormone/growth factor
Keywords: cystine-knot, helix bundle, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2006-03-24, released 2006-06-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.222
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDNF family receptor alpha-3
    Species: Homo sapiens [TaxId:9606]
    Gene: GFRA3
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: GDNF family receptor alpha-3
    Species: Homo sapiens [TaxId:9606]
    Gene: GFRA3
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: artemin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5T4W7 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.01: d2gh0c_
  • Chain 'D':
    Compound: artemin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5T4W7 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.01: d2gh0d_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gh0C (C:)
    dpgcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppg
    srpvsqpccrptryeavsfmdvnstwrtvdrlsatacgclg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gh0C (C:)
    dpgcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppg
    srpvsqpccrptryeavsfmdvnstwrtvdrlsatacgcl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gh0D (D:)
    dpgcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppg
    srpvsqpccrptryeavsfmdvnstwrtvdrlsatacgclg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gh0D (D:)
    pgcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgs
    rpvsqpccrptryeavsfmdvnstwrtvdrlsatacgcl