PDB entry 2ggp

View 2ggp on RCSB PDB site
Description: Solution structure of the Atx1-Cu(I)-Ccc2a complex
Class: chaperone, metal transport
Keywords: Copper transport, NMR, complex, Structural Genomics, Structural Proteomics in Europe, SPINE, CHAPERONE, METAL TRANSPORT
Deposited on 2006-03-24, released 2006-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metal homeostasis factor ATX1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ggpa_
  • Chain 'B':
    Compound: Probable copper-transporting ATPase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38995 (1-71)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d2ggpb2, d2ggpb3
  • Heterogens: CU1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ggpA (A:)
maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfileki
kktgkevrsgkql

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ggpB (B:)
arevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiie
dcgfdceilrds