PDB entry 2ggc

View 2ggc on RCSB PDB site
Description: Novel bacterial methionine aminopeptidase inhibitors
Class: hydrolase
Keywords: methionine amino peptidase, pita-bread fold, MAP inhibitor, antibacterial
Deposited on 2006-03-23, released 2006-06-13
The last revision prior to the SCOP 1.75 freeze date was dated 2007-04-24, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.12
AEROSPACI score: 1.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli
    Gene: map
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ggca1
  • Heterogens: CO, NA, MET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ggcA (A:)
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishde