PDB entry 2ggb

View 2ggb on RCSB PDB site
Description: Novel bacterial methionine aminopeptidase inhibitors
Class: hydrolase
Keywords: methionine amino peptidase, pita-bread fold, MAP inhibitor, antibacterial
Deposited on 2006-03-23, released 2006-06-13
The last revision prior to the SCOP 1.73 freeze date was dated 2007-04-24, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.185
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli
    Gene: map
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ggba1
  • Heterogens: CO, NA, U17, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ggbA (A:)
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishde