PDB entry 2ggb

View 2ggb on RCSB PDB site
Description: Novel bacterial methionine aminopeptidase inhibitors
Class: hydrolase
Keywords: methionine amino peptidase, pita-bread fold, MAP inhibitor, antibacterial, HYDROLASE
Deposited on 2006-03-23, released 2006-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli [TaxId:83333]
    Gene: map
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ggba_
  • Heterogens: CO, NA, U17, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ggbA (A:)
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishde