PDB entry 2gg5

View 2gg5 on RCSB PDB site
Description: Novel bacterial methionine aminopeptidase inhibitors
Class: hydrolase
Keywords: methionine amino peptidase, pita-bread fold, MAP inhibitor, antibacterial, HYDROLASE
Deposited on 2006-03-23, released 2006-06-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.195
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: map
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gg5a_
  • Heterogens: CO, NA, U19, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gg5A (A:)
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishde