PDB entry 2gg2

View 2gg2 on RCSB PDB site
Description: Novel bacterial methionine aminopeptidase inhibitors
Class: hydrolase
Keywords: methionine amino peptidase, pita-bread fold, MAP inhibitor, antibacterial, HYDROLASE
Deposited on 2006-03-23, released 2006-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.136
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: map
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gg2a_
  • Heterogens: CO, NA, U12, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gg2A (A:)
    aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
    yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
    gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
    qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
    dngceiltlrkddtipaiishde