PDB entry 2gfw

View 2gfw on RCSB PDB site
Description: Structure of wild type E. coli FabF (KASII)
Class: transferase
Keywords: FabF; KASII; ketoacyl synthase, TRANSFERASE
Deposited on 2006-03-23, released 2006-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 2
    Species: Escherichia coli [TaxId:562]
    Gene: fabF, fabJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gfwa1, d2gfwa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gfwA (A:)
    mrgshhhhhhgsacvskrrvvvtglgmlspvgntvestwkallagqsgislidhfdtsay
    atkfaglvkdfncediisrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaig
    sgigglglieenhtslmnggprkispffvpstivnmvaghltimyglrgpsisiatacts
    gvhnighaariiaygdadvmvaggaekastplgvggfgaaralstrndnpqaasrpwdke
    rdgfvlgdgagmlvleeyehakkrgakiyaelvgfgmssdayhmtsppengagaalaman
    alrdagieasqigyvnahgtstpagdkaeaqavktifgeaasrvlvsstksmtghllgaa
    gavesiysilalrdqavpptinldnpdegcdldfvphearqvsgmeytlcnsfgfggtng
    slifkki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gfwA (A:)
    krrvvvtglgmlspvgntvestwkallagqsgislidhfdtsayatkfaglvkdfncedi
    isrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaigsgigglglieenhtsl
    mnggprkispffvpstivnmvaghltimyglrgpsisiatactsgvhnighaariiaygd
    advmvaggaekastplgvggfgaaralstrndnpqaasrpwdkerdgfvlgdgagmlvle
    eyehakkrgakiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvn
    ahgtstpagdkaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqa
    vpptinldnpdegcdldfvphearqvsgmeytlcnsfgfggtngslifkki