PDB entry 2gfs

View 2gfs on RCSB PDB site
Description: P38 Kinase Crystal Structure in complex with RO3201195
Class: signaling protein, transferase
Keywords: p38; map kinase; serine/threonine kinase, signaling protein, transferase
Deposited on 2006-03-23, released 2006-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.205
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gfsa_
  • Heterogens: PQB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gfsA (A:)
    mrgshhhhhhgsmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktgl
    rvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthl
    mgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkild
    fglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdh
    idqlklilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekm
    lvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisf
    vpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gfsA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfhtddemtgyvatrwy
    rapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellk
    kissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayf
    aqyhdpddepvadpydqsfesrdllidewksltydevisfvppp