PDB entry 2gfc

View 2gfc on RCSB PDB site
Description: cAMP-dependent protein kinase PKA catalytic subunit with PKI-5-24
Class: transferase
Keywords: binary complex, peptide inhibitor
Deposited on 2006-03-21, released 2006-05-23
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.194
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: BOS TAURUS
    Gene: PRKACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00517 (Start-349)
      • modified residue (196)
      • modified residue (337)
    Domains in SCOP 1.73: d2gfca1
  • Chain 'I':
    Compound: cAMP-dependent protein kinase inhibitor alpha
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: OCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gfcA (A:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gfcA (A:)
    svkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamki
    ldkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlr
    rigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkg
    rtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsg
    kvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveap
    fipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'I':
    No sequence available.