PDB entry 2gfb

View 2gfb on RCSB PDB site
Description: crystal structure of a catalytic fab having esterase-like activity
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1994-07-07, released 1994-09-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.213
AEROSPACI score: -1.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg2a cnj206 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAG43418 (3-213)
      • conflict (27)
      • conflict (29-31)
      • conflict (33)
      • conflict (38)
      • conflict (49-50)
      • conflict (52)
      • conflict (83)
      • conflict (95)
      • insertion (98)
      • conflict (101-106)
      • conflict (108-109)
    Domains in SCOPe 2.03: d2gfba1, d2gfba2
  • Chain 'B':
    Compound: igg2a cnj206 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC98952 (0-218)
      • conflict (12)
      • conflict (17)
      • conflict (29)
      • conflict (31-32)
      • conflict (34)
      • conflict (39)
      • conflict (43)
      • conflict (49)
      • conflict (51)
      • conflict (54-55)
      • insertion (57)
      • conflict (58)
      • conflict (60)
      • conflict (64)
      • conflict (74)
      • conflict (79)
      • conflict (81-82)
      • insertion (98)
      • conflict (100-103)
      • conflict (103)
      • conflict (106)
    Domains in SCOPe 2.03: d2gfbb1, d2gfbb2
  • Chain 'C':
    Compound: igg2a cnj206 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAG43418 (3-213)
      • conflict (27)
      • conflict (29-31)
      • conflict (33)
      • conflict (38)
      • conflict (49-50)
      • conflict (52)
      • conflict (83)
      • conflict (95)
      • insertion (98)
      • conflict (101-106)
      • conflict (108-109)
    Domains in SCOPe 2.03: d2gfbc1, d2gfbc2
  • Chain 'D':
    Compound: igg2a cnj206 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC98952 (0-218)
      • conflict (12)
      • conflict (17)
      • conflict (29)
      • conflict (31-32)
      • conflict (34)
      • conflict (39)
      • conflict (43)
      • conflict (49)
      • conflict (51)
      • conflict (54-55)
      • insertion (57)
      • conflict (58)
      • conflict (60)
      • conflict (64)
      • conflict (74)
      • conflict (79)
      • conflict (81-82)
      • insertion (98)
      • conflict (100-103)
      • conflict (103)
      • conflict (106)
    Domains in SCOPe 2.03: d2gfbd1, d2gfbd2
  • Chain 'E':
    Compound: igg2a cnj206 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAG43418 (3-213)
      • conflict (27)
      • conflict (29-31)
      • conflict (33)
      • conflict (38)
      • conflict (49-50)
      • conflict (52)
      • conflict (83)
      • conflict (95)
      • insertion (98)
      • conflict (101-106)
      • conflict (108-109)
    Domains in SCOPe 2.03: d2gfbe1, d2gfbe2
  • Chain 'F':
    Compound: igg2a cnj206 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC98952 (0-218)
      • conflict (12)
      • conflict (17)
      • conflict (29)
      • conflict (31-32)
      • conflict (34)
      • conflict (39)
      • conflict (43)
      • conflict (49)
      • conflict (51)
      • conflict (54-55)
      • insertion (57)
      • conflict (58)
      • conflict (60)
      • conflict (64)
      • conflict (74)
      • conflict (79)
      • conflict (81-82)
      • insertion (98)
      • conflict (100-103)
      • conflict (103)
      • conflict (106)
    Domains in SCOPe 2.03: d2gfbf1, d2gfbf2
  • Chain 'G':
    Compound: igg2a cnj206 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAG43418 (3-213)
      • conflict (27)
      • conflict (29-31)
      • conflict (33)
      • conflict (38)
      • conflict (49-50)
      • conflict (52)
      • conflict (83)
      • conflict (95)
      • insertion (98)
      • conflict (101-106)
      • conflict (108-109)
    Domains in SCOPe 2.03: d2gfbg1, d2gfbg2
  • Chain 'H':
    Compound: igg2a cnj206 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC98952 (0-218)
      • conflict (12)
      • conflict (17)
      • conflict (29)
      • conflict (31-32)
      • conflict (34)
      • conflict (39)
      • conflict (43)
      • conflict (49)
      • conflict (51)
      • conflict (54-55)
      • insertion (57)
      • conflict (58)
      • conflict (60)
      • conflict (64)
      • conflict (74)
      • conflict (79)
      • conflict (81-82)
      • insertion (98)
      • conflict (100-103)
      • conflict (103)
      • conflict (106)
    Domains in SCOPe 2.03: d2gfbh1, d2gfbh2
  • Chain 'I':
    Compound: igg2a cnj206 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAG43418 (3-213)
      • conflict (27)
      • conflict (29-31)
      • conflict (33)
      • conflict (38)
      • conflict (49-50)
      • conflict (52)
      • conflict (83)
      • conflict (95)
      • insertion (98)
      • conflict (101-106)
      • conflict (108-109)
    Domains in SCOPe 2.03: d2gfbi1, d2gfbi2
  • Chain 'J':
    Compound: igg2a cnj206 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC98952 (0-218)
      • conflict (12)
      • conflict (17)
      • conflict (29)
      • conflict (31-32)
      • conflict (34)
      • conflict (39)
      • conflict (43)
      • conflict (49)
      • conflict (51)
      • conflict (54-55)
      • insertion (57)
      • conflict (58)
      • conflict (60)
      • conflict (64)
      • conflict (74)
      • conflict (79)
      • conflict (81-82)
      • insertion (98)
      • conflict (100-103)
      • conflict (103)
      • conflict (106)
    Domains in SCOPe 2.03: d2gfbj1, d2gfbj2
  • Chain 'K':
    Compound: igg2a cnj206 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAG43418 (3-213)
      • conflict (27)
      • conflict (29-31)
      • conflict (33)
      • conflict (38)
      • conflict (49-50)
      • conflict (52)
      • conflict (83)
      • conflict (95)
      • insertion (98)
      • conflict (101-106)
      • conflict (108-109)
    Domains in SCOPe 2.03: d2gfbk1, d2gfbk2
  • Chain 'L':
    Compound: igg2a cnj206 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC98952 (0-218)
      • conflict (12)
      • conflict (17)
      • conflict (29)
      • conflict (31-32)
      • conflict (34)
      • conflict (39)
      • conflict (43)
      • conflict (49)
      • conflict (51)
      • conflict (54-55)
      • insertion (57)
      • conflict (58)
      • conflict (60)
      • conflict (64)
      • conflict (74)
      • conflict (79)
      • conflict (81-82)
      • insertion (98)
      • conflict (100-103)
      • conflict (103)
      • conflict (106)
    Domains in SCOPe 2.03: d2gfbl1, d2gfbl2
  • Chain 'M':
    Compound: igg2a cnj206 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAG43418 (3-213)
      • conflict (27)
      • conflict (29-31)
      • conflict (33)
      • conflict (38)
      • conflict (49-50)
      • conflict (52)
      • conflict (83)
      • conflict (95)
      • insertion (98)
      • conflict (101-106)
      • conflict (108-109)
    Domains in SCOPe 2.03: d2gfbm1, d2gfbm2
  • Chain 'N':
    Compound: igg2a cnj206 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC98952 (0-218)
      • conflict (12)
      • conflict (17)
      • conflict (29)
      • conflict (31-32)
      • conflict (34)
      • conflict (39)
      • conflict (43)
      • conflict (49)
      • conflict (51)
      • conflict (54-55)
      • insertion (57)
      • conflict (58)
      • conflict (60)
      • conflict (64)
      • conflict (74)
      • conflict (79)
      • conflict (81-82)
      • insertion (98)
      • conflict (100-103)
      • conflict (103)
      • conflict (106)
    Domains in SCOPe 2.03: d2gfbn1, d2gfbn2
  • Chain 'O':
    Compound: igg2a cnj206 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAG43418 (3-213)
      • conflict (27)
      • conflict (29-31)
      • conflict (33)
      • conflict (38)
      • conflict (49-50)
      • conflict (52)
      • conflict (83)
      • conflict (95)
      • insertion (98)
      • conflict (101-106)
      • conflict (108-109)
    Domains in SCOPe 2.03: d2gfbo1, d2gfbo2
  • Chain 'P':
    Compound: igg2a cnj206 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC98952 (0-218)
      • conflict (12)
      • conflict (17)
      • conflict (29)
      • conflict (31-32)
      • conflict (34)
      • conflict (39)
      • conflict (43)
      • conflict (49)
      • conflict (51)
      • conflict (54-55)
      • insertion (57)
      • conflict (58)
      • conflict (60)
      • conflict (64)
      • conflict (74)
      • conflict (79)
      • conflict (81-82)
      • insertion (98)
      • conflict (100-103)
      • conflict (103)
      • conflict (106)
    Domains in SCOPe 2.03: d2gfbp1, d2gfbp2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbA (A:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbB (B:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbC (C:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbD (D:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbE (E:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbF (F:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbG (G:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbH (H:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbI (I:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbJ (J:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbK (K:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbL (L:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbM (M:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbN (N:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbO (O:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilrggaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gfbP (P:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg