PDB entry 2gfa

View 2gfa on RCSB PDB site
Description: double tudor domain complex structure
Class: metal binding protein
Keywords: double tudor domain, tudor tandem, trimethyl histone H3 lysine 4, jmjc domain containing, METAL BINDING PROTEIN
Deposited on 2006-03-21, released 2006-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Jumonji domain-containing protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: JMJD2A, JMJD2, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gfaa1, d2gfaa2
  • Chain 'B':
    Compound: Jumonji domain-containing protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: JMJD2A, JMJD2, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gfab1, d2gfab2
  • Chain 'C':
    Compound: peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2GFA (0-End)
  • Chain 'D':
    Compound: peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2GFA (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gfaA (A:)
    gpalqsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdcl
    qfgppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gfaA (A:)
    alqsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivgppaege
    vvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytlde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gfaB (B:)
    gpalqsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdcl
    qfgppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gfaB (B:)
    lqsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsgppaege
    vvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.