PDB entry 2gf7

View 2gf7 on RCSB PDB site
Description: Double tudor domain structure
Class: metal binding protein
Keywords: double tudor domain, tudor tandem, trimethyl histone H3 lysine 4, trimethyl hisone demethylase, jmjc domain containing
Deposited on 2006-03-21, released 2006-05-02
The last revision prior to the SCOP 1.75 freeze date was dated 2006-05-16, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.225
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Jumonji domain-containing protein 2A
    Species: HOMO SAPIENS
    Gene: JMJD2A, JMJD2, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2gf7a1, d2gf7a2
  • Chain 'B':
    Compound: Jumonji domain-containing protein 2A
    Species: HOMO SAPIENS
    Gene: JMJD2A, JMJD2, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2gf7b1, d2gf7b2
  • Chain 'C':
    Compound: Jumonji domain-containing protein 2A
    Species: HOMO SAPIENS
    Gene: JMJD2A, JMJD2, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2gf7c1, d2gf7c2
  • Chain 'D':
    Compound: Jumonji domain-containing protein 2A
    Species: HOMO SAPIENS
    Gene: JMJD2A, JMJD2, KIAA0677
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2gf7d1, d2gf7d2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gf7A (A:)
    gpalqsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdcl
    qfgppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf7A (A:)
    qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfgp
    paegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gf7B (B:)
    gpalqsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdcl
    qfgppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf7B (B:)
    qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfgp
    paegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gf7C (C:)
    gpalqsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdcl
    qfgppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf7C (C:)
    qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfgp
    paegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gf7D (D:)
    gpalqsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdcl
    qfgppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf7D (D:)
    qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfgp
    paegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp