PDB entry 2gf4

View 2gf4 on RCSB PDB site
Description: Crystal structure of Vng1086c from Halobacterium salinarium (Halobacterium halobium). Northeast Structural Genomics Target HsR14
Class: structural genomics, unknown function
Keywords: Hsr14, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-03-21, released 2006-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Vng1086c
    Species: Halobacterium salinarum [TaxId:64091]
    Gene: VNG1086C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HQM9 (0-End)
      • modified residue (0)
      • modified residue (12)
      • modified residue (65)
      • modified residue (80)
    Domains in SCOPe 2.08: d2gf4a1
  • Chain 'B':
    Compound: Protein Vng1086c
    Species: Halobacterium salinarum [TaxId:64091]
    Gene: VNG1086C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HQM9 (0-End)
      • modified residue (0)
      • modified residue (12)
      • modified residue (65)
    Domains in SCOPe 2.08: d2gf4b_
  • Heterogens: CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gf4A (A:)
    mhkdellelheqmvnikdqflgfdhvdetafaayeeldvepshvhksksehkhavfllgn
    alaaamsedefssagriskrmeeladdasnqllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf4A (A:)
    mhkdellelheqmvnikdqflgfdhvdetafaayeeldvepshvhksksehkhavfllgn
    alaaamsedefssagriskrmeeladdas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gf4B (B:)
    mhkdellelheqmvnikdqflgfdhvdetafaayeeldvepshvhksksehkhavfllgn
    alaaamsedefssagriskrmeeladdasnqllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf4B (B:)
    mhkdellelheqmvnikdqflgfdhvdetafaayeeldvepshvhksksehkhavfllgn
    alaaamsedefssag