PDB entry 2gf3

View 2gf3 on RCSB PDB site
Description: Structure of the complex of monomeric sarcosine with its substrate analogue inhibitor 2-furoic acid at 1.3 A resolution.
Class: Oxidoreductase
Keywords: FLAVOPROTEIN OXIDASE, INHIBITOR 2-FUROIC ACID, Oxidoreductase
Deposited on 2006-03-21, released 2007-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.17
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monomeric sarcosine oxidase
    Species: Bacillus sp. [TaxId:1409]
    Gene: soxA, sox
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gf3a1, d2gf3a2
  • Chain 'B':
    Compound: Monomeric sarcosine oxidase
    Species: Bacillus sp. [TaxId:1409]
    Gene: soxA, sox
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gf3b1, d2gf3b2
  • Heterogens: CL, PO4, FAD, FOA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gf3A (A:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslqktti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf3A (A:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gf3B (B:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslqktti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf3B (B:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslq