PDB entry 2gf2

View 2gf2 on RCSB PDB site
Description: Crystal structure of human hydroxyisobutyrate dehydrogenase
Class: oxidoreductase
Keywords: dehydrogenase, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
Deposited on 2006-03-21, released 2006-04-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.207
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HIBADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31937 (1-295)
      • initiating methionine (0)
    Domains in SCOPe 2.05: d2gf2a1, d2gf2a2
  • Chain 'B':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HIBADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31937 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.05: d2gf2b1, d2gf2b2
  • Chain 'C':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HIBADH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2gf2c1, d2gf2c2
  • Chain 'D':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: HIBADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31937 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.05: d2gf2d1, d2gf2d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gf2A (A:)
    mpvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadri
    itmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapv
    sggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycgavgtgqaakicnnmllais
    migtaeamnlgirlgldpkllakilnmssgrcwssdtynpvpgvmdgvpsannyqggfgt
    tlmakdlglaqdsatstkspillgslahqiyrmmcakgyskkdfssvfqflreeet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gf2B (B:)
    mpvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadri
    itmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapv
    sggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycgavgtgqaakicnnmllais
    migtaeamnlgirlgldpkllakilnmssgrcwssdtynpvpgvmdgvpsannyqggfgt
    tlmakdlglaqdsatstkspillgslahqiyrmmcakgyskkdfssvfqflreeet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf2B (B:)
    mpvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadri
    itmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapv
    sggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycgavgtgqaakicnnmllais
    migtaeamnlgirlgldpkllakilnmssgrcwssdtynpvpgvmdgvpsannyqggfgt
    tlmakdlglaqdsatstkspillgslahqiyrmmcakgyskkdfssvfqflre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gf2C (C:)
    mpvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadri
    itmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapv
    sggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycgavgtgqaakicnnmllais
    migtaeamnlgirlgldpkllakilnmssgrcwssdtynpvpgvmdgvpsannyqggfgt
    tlmakdlglaqdsatstkspillgslahqiyrmmcakgyskkdfssvfqflreeet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf2C (C:)
    pvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadrii
    tmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapvs
    ggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycgavgtgqaakicnnmllaism
    igtaeamnlgirlgldpkllakilnmssgrcwssdtynpvpgvmdgvpsannyqggfgtt
    lmakdlglaqdsatstkspillgslahqiyrmmcakgyskkdfssvfqflr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gf2D (D:)
    mpvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadri
    itmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapv
    sggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycgavgtgqaakicnnmllais
    migtaeamnlgirlgldpkllakilnmssgrcwssdtynpvpgvmdgvpsannyqggfgt
    tlmakdlglaqdsatstkspillgslahqiyrmmcakgyskkdfssvfqflreeet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gf2D (D:)
    mpvgfiglgnmgnpmaknlmkhgypliiydvfpdackefqdageqvvsspadvaekadri
    itmlptsinaieaysgangilkkvkkgsllidsstidpavskelakevekmgavfmdapv
    sggvgaarsgnltfmvggvedefaaaqellgcmgsnvvycgavgtgqaakicnnmllais
    migtaeamnlgirlgldpkllakilnmssgrcwssdtynpvpgvmdgvpsannyqggfgt
    tlmakdlglaqdsatstkspillgslahqiyrmmcakgyskkdfssvfqflree