SCOP 1.75: Structural Classification of Proteins

PDB entry 2gf1

View 2gf1 on RCSB PDB site
Description: solution structure of human insulin-like growth factor 1: a nuclear magnetic resonance and restrained molecular dynamics study
Class: growth factor
Keywords: growth factor
Deposited on 1991-01-23, released 1993-04-15
The last revision prior to the SCOP 1.75 freeze date was dated 1993-04-15, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: insulin-like growth factor I
Species: HOMO SAPIENS
Database cross-references and differences (RAF-indexed):
- Uniprot P01343 (0-69)
Domains in SCOP 1.75: d2gf1a_

PDB Chain Sequences:

Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)

>2gf1A (A:)
gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
caplkpaksa