PDB entry 2gey

View 2gey on RCSB PDB site
Description: Crystal Structure of AclR a putative hydroxylase from Streptomyces galilaeus
Class: oxidoreductase
Keywords: alpha+beta barrel
Deposited on 2006-03-21, released 2006-07-18
The last revision prior to the SCOP 1.75 freeze date was dated 2006-07-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AclR protein
    Species: Streptomyces galilaeus
    Gene: aclr
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1XDX7 (Start-144)
      • his tag (145-157)
    Domains in SCOP 1.75: d2geya1
  • Chain 'B':
    Compound: AclR protein
    Species: Streptomyces galilaeus
    Gene: aclr
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: AclR protein
    Species: Streptomyces galilaeus
    Gene: aclr
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1XDX7 (Start-144)
      • his tag (145-150)
    Domains in SCOP 1.75: d2geyc1
  • Chain 'D':
    Compound: AclR protein
    Species: Streptomyces galilaeus
    Gene: aclr
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PG4, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2geyA (A:)
    msmaerkalclemvaawnrwdlsgiikhwspdivhysednevssadmvklmegglkafpd
    lqlevksimaeedrvalritvtathqgefmgvqptgqrvswhlveelrfvdgkvvehwdv
    inmrpllvrlgklpdvpkvvleasaklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2geyA (A:)
    smaerkalclemvaawnrwdlsgiikhwspdivhysednevssadmvklmegglkafpdl
    qlevksimaeedrvalritvtathqgefmgvqptgqrvswhlveelrfvdgkvvehwdvi
    nmrpllvrlgklpdvpkvvleasaklaaalehhhhhh
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2geyC (C:)
    msmaerkalclemvaawnrwdlsgiikhwspdivhysednevssadmvklmegglkafpd
    lqlevksimaeedrvalritvtathqgefmgvqptgqrvswhlveelrfvdgkvvehwdv
    inmrpllvrlgklpdvpkvvleasaklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2geyC (C:)
    smaerkalclemvaawnrwdlsgiikhwspdivhysednevssadmvklmegglkafpdl
    qlevksimaeedrvalritvtathqgefmgvqptgqrvswhlveelrfvdgkvvehwdvi
    nmrpllvrlgklpdvpkvvleasaklaaal
    

  • Chain 'D':
    No sequence available.