PDB entry 2gex

View 2gex on RCSB PDB site
Description: Crystal structure of SnoaL2 a putative hydroxylase from Streptomyces nogalater
Class: oxidoreductase
Keywords: alpha+beta barrel, OXIDOREDUCTASE
Deposited on 2006-03-21, released 2006-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SnoL
    Species: Streptomyces nogalater [TaxId:38314]
    Gene: snoal2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RN64 (Start-138)
      • modified residue (12)
      • modified residue (51)
      • modified residue (76)
      • modified residue (90)
      • expression tag (139-146)
    Domains in SCOPe 2.08: d2gexa1, d2gexa2
  • Chain 'B':
    Compound: SnoL
    Species: Streptomyces nogalater [TaxId:38314]
    Gene: snoal2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RN64
      • modified residue (12)
      • modified residue (51)
      • modified residue (76)
      • modified residue (90)
    Domains in SCOPe 2.08: d2gexb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gexA (A:)
    msttankerclemvaawnrwdvsgvvahwapdvvhyddedkpvsaeevvrrmnsaveafp
    dlrldvrsivgegdrvmlritcsathqgvfmgiaptgrkvrwtyleelrfseagkvvehw
    dvfnfsplfrdlgvvpdglklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gexA (A:)
    sttankerclemvaawnrwdvsgvvahwapdvvhyddedkpvsaeevvrrmnsaveafpd
    lrldvrsivgegdrvmlritcsathqgvfmgiaptgrkvrwtyleelrfseagkvvehwd
    vfnfsplfrdlgvvpdglklaaaleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gexB (B:)
    msttankerclemvaawnrwdvsgvvahwapdvvhyddedkpvsaeevvrrmnsaveafp
    dlrldvrsivgegdrvmlritcsathqgvfmgiaptgrkvrwtyleelrfseagkvvehw
    dvfnfsplfrdlgvvpdglklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gexB (B:)
    sttankerclemvaawnrwdvsgvvahwapdvvhyddedkpvsaeevvrrmnsaveafpd
    lrldvrsivgegdrvmlritcsathqgvfmgiaptgrkvrwtyleelrfseagkvvehwd
    vfnfsplfrdlgv