PDB entry 2ger

View 2ger on RCSB PDB site
Description: Crystal Structure and Oxidative Mechanism of Human Pyrroline-5-carboxylate Reductase
Class: oxidoreductase
Keywords: crystal structure,Oxidative Mechanism of Human Pyrroline-5-carboxylate, OXIDOREDUCTASE
Deposited on 2006-03-20, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.233
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2gera1, d2gera2, d2gera3
  • Chain 'B':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2gerb1, d2gerb2, d2gerb3
  • Chain 'C':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2gerc1, d2gerc2, d2gerc3
  • Chain 'D':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2gerd1, d2gerd2, d2gerd3
  • Chain 'E':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32322 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2gere1, d2gere2, d2gere3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gerA (A:)
    ramsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqeqvspaaikktildkvkldspagt
    alspsghtkllprslapagkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gerA (A:)
    ramsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gerB (B:)
    ramsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqeqvspaaikktildkvkldspagt
    alspsghtkllprslapagkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gerB (B:)
    ramsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvktphnket
    vqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvir
    cmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgpa
    yaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggati
    halhvlesggfrsllinaveascirtrelqsmadqe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gerC (C:)
    ramsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqeqvspaaikktildkvkldspagt
    alspsghtkllprslapagkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gerC (C:)
    ramsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gerD (D:)
    ramsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqeqvspaaikktildkvkldspagt
    alspsghtkllprslapagkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gerD (D:)
    ramsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gerE (E:)
    ramsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqeqvspaaikktildkvkldspagt
    alspsghtkllprslapagkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gerE (E:)
    ramsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
    tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
    rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgp
    ayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggat
    ihalhvlesggfrsllinaveascirtrelqsmadqe