PDB entry 2gen

View 2gen on RCSB PDB site
Description: Structural Genomics, the crystal structure of a probable transcriptional regulator from Pseudomonas aeruginosa PAO1
Class: transcription
Keywords: APC6095, Pseudomonas aeruginosa PA01, TetR family, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION
Deposited on 2006-03-20, released 2006-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.212
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable transcriptional regulator
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: 15597033
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I2Q9 (Start-194)
      • modified residue (31)
      • modified residue (147)
    Domains in SCOPe 2.08: d2gena1, d2gena2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2genA (A:)
    ghmgrssrkdeilqaalacfsehgvdattiemirdrsgasigslyhhfgnkerihgelyl
    agigqyaalleagfararsaeetvrllvtsyidwvvanpdwarfilhsrgrveagelger
    lradnqahfarihaalagyraeglfrempddcfasvvigpahdlarqwlagrtrvaladc
    rellaqvawdsvraags
    

    Sequence, based on observed residues (ATOM records): (download)
    >2genA (A:)
    rkdeilqaalacfsehgvdattiemirdrsgasigslyhhfgnkerihgelylagigqya
    alleagfararsaeetvrllvtsyidwvvanpdwarfilhsrgrveagelgerlradnqa
    hfarihaalagyraeglfrempddcfasvvigpahdlarqwlagrtrvaladcrellaqv
    awdsvraa