PDB entry 2gec

View 2gec on RCSB PDB site
Description: Structure of the N-terminal domain of avian infectious bronchitis virus nucleocapsid protein (strain Gray) in a novel dimeric arrangement
Class: viral protein
Keywords: Nucleocapsid protein, N protein, Coronavirus, IBV N protein, VIRAL, VIRAL PROTEIN
Deposited on 2006-03-19, released 2006-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.207
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleocapsid protein
    Species: Infectious bronchitis virus [TaxId:11120]
    Gene: N
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32923 (Start-138)
      • see remark 999 (40)
    Domains in SCOPe 2.06: d2geca1
  • Chain 'B':
    Compound: nucleocapsid protein
    Species: Infectious bronchitis virus [TaxId:11120]
    Gene: N
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32923 (0-138)
      • see remark 999 (40)
    Domains in SCOPe 2.06: d2gecb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gecA (A:)
    prppkvgssgnaswfqaikakklnspqpkfegsgvpdnenlktsqqhgywrrqarfkpgk
    grrkpvpdawyfyytgtgpaadlnwgdsqdgivwvaakgadvksrsnqgtrdpdkfdqyp
    lrfsdggpdgnfrwdfipl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gecA (A:)
    rppkvgssgnaswfqaikakklnspqpkfegsgvpdnenlktsqqhgywrrqarfkpgkg
    rrkpvpdawyfyytgtgpaadlnwgdsqdgivwvaakgadvksrsnqgtrdpdkfdqypl
    rfsdggpdgnfrwdfipl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gecB (B:)
    prppkvgssgnaswfqaikakklnspqpkfegsgvpdnenlktsqqhgywrrqarfkpgk
    grrkpvpdawyfyytgtgpaadlnwgdsqdgivwvaakgadvksrsnqgtrdpdkfdqyp
    lrfsdggpdgnfrwdfipl