PDB entry 2gdy

View 2gdy on RCSB PDB site
Description: Solution structure of the B. brevis TycC3-PCP in A-state
Class: ligase/TRANSPORT PROTEIN
Keywords: Three-helix bundle
Deposited on 2006-03-17, released 2006-08-01
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrocidine synthetase III
  Species: Brevibacillus parabrevis
  Gene: TYCC
  Database cross-references and differences (RAF-indexed):
  • Uniprot O30409 (1-82)
    • initiating methionine (0)
    • engineered (1)
    • cloning artifact (83-84)
  Domains in SCOP 1.75: d2gdya1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gdyA (A:)
  mgvteaqyvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyq
  velplkvlfaqptikalaqyvatrs