PDB entry 2gdx

View 2gdx on RCSB PDB site
Description: Solution structure of the B. brevis TycC3-PCP in H-state
Class: ligase/TRANSPORT PROTEIN
Keywords: Three-helix bundle, ligase/TRANSPORT PROTEIN COMPLEX
Deposited on 2006-03-17, released 2006-08-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrocidine synthetase III
    Species: Brevibacillus parabrevis [TaxId:54914]
    Gene: TYCC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30409 (1-82)
      • initiating methionine (0)
      • engineered (1)
      • cloning artifact (83-84)
    Domains in SCOPe 2.04: d2gdxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gdxA (A:)
    mgvteaqyvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyq
    velplkvlfaqptikalaqyvatrs