PDB entry 2gdw

View 2gdw on RCSB PDB site
Description: Solution structure of the B. brevis TycC3-PCP in A/H-state
Class: ligase/transport protein
Keywords: Three-helix bundle
Deposited on 2006-03-17, released 2006-08-01
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-01, with a file datestamp of 2007-06-04.
Experiment type: NMR19
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrocidine synthetase III
  Species: Brevibacillus parabrevis
  Gene: TYCC
  Database cross-references and differences (RAF-indexed):
  • Uniprot O30409 (1-82)
    • initiating methionine (0)
    • engineered (1)
    • cloning artifact (83-84)
  Domains in SCOP 1.73: d2gdwa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gdwA (A:)
  mgvteaqyvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyq
  velplkvlfaqptikalaqyvatrs