PDB entry 2gdu

View 2gdu on RCSB PDB site
Description: E232Q mutant of sucrose phosphorylase from BIFIDOBACTERIUM ADOLESCENTIS in complex with sucrose
Class: transferase
Keywords: beta-alpha-barrels, dimer, glycoside hydrolase, transferase
Deposited on 2006-03-17, released 2006-09-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sucrose phosphorylase
    Species: Bifidobacterium adolescentis [TaxId:1680]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84HQ2 (0-503)
      • engineered (231)
      • modified residue (355)
    Domains in SCOPe 2.04: d2gdua1, d2gdua2
  • Chain 'B':
    Compound: sucrose phosphorylase
    Species: Bifidobacterium adolescentis [TaxId:1680]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84HQ2 (0-503)
      • engineered (231)
      • modified residue (355)
    Domains in SCOPe 2.04: d2gdub1, d2gdub2
  • Heterogens: SUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gduA (A:)
    mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk
    vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp
    ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq
    maashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleiliqvhsyykkq
    veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd
    qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyqvnstyysalgcndqh
    yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv
    kalnalakfrneldafdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpva
    mlewedsagdhrsddlianppvva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gduB (B:)
    mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk
    vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp
    ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq
    maashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleiliqvhsyykkq
    veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd
    qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyqvnstyysalgcndqh
    yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv
    kalnalakfrneldafdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpva
    mlewedsagdhrsddlianppvva