PDB entry 2gds

View 2gds on RCSB PDB site
Description: Interrupting the Hydrogen Bonding Network at the Active Site of Human Manganese Superoxide Dismutase
Class: oxidoreductase
Keywords: Human Manganese Superoxide Dismutase, H30N mutation, OXIDOREDUCTASE
Deposited on 2006-03-16, released 2006-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (29)
    Domains in SCOPe 2.08: d2gdsa1, d2gdsa2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (29)
    Domains in SCOPe 2.08: d2gdsb1, d2gdsb2
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (29)
    Domains in SCOPe 2.08: d2gdsc1, d2gdsc2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (29)
    Domains in SCOPe 2.08: d2gdsd1, d2gdsd2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gdsA (A:)
    khslpdlpydygalephinaqimqlhhsknhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gdsB (B:)
    khslpdlpydygalephinaqimqlhhsknhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gdsC (C:)
    khslpdlpydygalephinaqimqlhhsknhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gdsD (D:)
    khslpdlpydygalephinaqimqlhhsknhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk