PDB entry 2gdm

View 2gdm on RCSB PDB site
Description: leghemoglobin (oxy)
Class: oxygen transport
Keywords: oxygen transport, leghemoglobin, lupine
Deposited on 1994-09-14, released 1995-10-15
The last revision prior to the SCOP 1.75 freeze date was dated 1995-10-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.158
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leghemoglobin (oxy)
    Species: Lupinus luteus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02240 (0-152)
      • conflict (78)
      • conflict (149)
    Domains in SCOP 1.75: d2gdma_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gdmA (A:)
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa