PDB entry 2gdj

View 2gdj on RCSB PDB site
Description: Delta-62 RADA recombinase in complex with AMP-PNP and magnesium
Class: recombination
Keywords: ATPase, protein-ATP complex, recombination
Deposited on 2006-03-16, released 2006-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gdja_
  • Heterogens: MG, ANP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gdjA (A:)
    gshmgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqs
    cvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntf
    varaynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhm
    atlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrva
    klydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gdjA (A:)
    gfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnl
    qnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvara
    ynsdmqmlfaekiedliqegnniklvvidsltstfrneygklaerqqklgrhmatlnkla
    dlfncvvlvtnqvghaatfrffvrkgkgdkrvaklydsphlpdaeaifritekgiqd