PDB entry 2gdg

View 2gdg on RCSB PDB site
Description: Crystal structure of covalently modified macrophage inhibitory factor
Class: isomerase
Keywords: Pro-1 pucker, ISOMERASE
Deposited on 2006-03-16, released 2006-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.148
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Mus musculus [TaxId:10090]
    Gene: MIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gdga_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Mus musculus [TaxId:10090]
    Gene: MIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gdgb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Mus musculus [TaxId:10090]
    Gene: MIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gdgc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gdgA (A:)
pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs
lhsigkiggaqnrnyskllcgllsdrlhispdrvyinyydmnaanvgwngstfa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gdgB (B:)
pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs
lhsigkiggaqnrnyskllcgllsdrlhispdrvyinyydmnaanvgwngstfa

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gdgC (C:)
pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs
lhsigkiggaqnrnyskllcgllsdrlhispdrvyinyydmnaanvgwngstfa