PDB entry 2gdd

View 2gdd on RCSB PDB site
Description: Human beta II tryptase with inhibitor CRA-27592
Class: hydrolase
Keywords: Serine protease, HYDROLASE
Deposited on 2006-03-15, released 2006-04-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.215
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptase beta-2
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSB2, TPS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gdda_
  • Chain 'B':
    Compound: Tryptase beta-2
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSB2, TPS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gddb_
  • Chain 'C':
    Compound: Tryptase beta-2
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSB2, TPS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gddc_
  • Chain 'D':
    Compound: Tryptase beta-2
    Species: Homo sapiens [TaxId:9606]
    Gene: TPSB2, TPS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gddd_
  • Heterogens: 5AM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gddA (A:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gddA (A:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gddB (B:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gddB (B:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gddC (C:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gddC (C:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gddD (D:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpkkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gddD (D:)
    ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
    reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
    pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
    cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
    vpk