PDB entry 2gdb

View 2gdb on RCSB PDB site
Description: X-ray structure of At1g77540-Coenzyme A Complex
Class: transferase
Keywords: CoA, Coenzyme-A, COG2388 Family, acetyltransferase, At1g77540, structural genomics functional follow-up study, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG
Deposited on 2006-03-15, released 2006-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2006-10-17, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.164
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein At1g77540
    Species: Arabidopsis thaliana
    Gene: At1g77540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gdba_
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gdbA (A:)
    mateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
    afehasshsisiipscsyvsdtflprnpswkplihsevfkssi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gdbA (A:)
    ppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeh
    asshsisiipscsyvsdtflprnpswkplih