PDB entry 2gdb
View 2gdb on RCSB PDB site
Description: X-ray structure of At1g77540-Coenzyme A Complex
Class: transferase
Keywords: CoA, Coenzyme-A, COG2388 Family, acetyltransferase, At1g77540,
structural genomics functional follow-up study, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG
Deposited on
2006-03-15, released
2006-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated
2006-10-17, with a file datestamp of
2007-04-25.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.164
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protein At1g77540
Species: Arabidopsis thaliana
Gene: At1g77540
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2gdba_ - Heterogens: COA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2gdbA (A:)
mateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
afehasshsisiipscsyvsdtflprnpswkplihsevfkssi
Sequence, based on observed residues (ATOM records): (download)
>2gdbA (A:)
ppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeh
asshsisiipscsyvsdtflprnpswkplih