PDB entry 2gda

View 2gda on RCSB PDB site
Description: refined solution structure of the glucocorticoid receptor dna-binding domain
Deposited on 1994-03-15, released 1994-06-22
The last revision prior to the SCOP 1.57 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2gda__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gda_ (-)
    lclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryr
    kclqagmnlear