PDB entry 2gcy

View 2gcy on RCSB PDB site
Description: humanized antibody C25 Fab fragment
Class: immune system
Keywords: antibody fragment mouse humanized
Deposited on 2006-03-14, released 2007-03-27
The last revision prior to the SCOP 1.75 freeze date was dated 2007-03-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: huC25 fab fragment light chain
    Species: MUS MUSCULUS
    Gene: humanized mouse gene
    Domains in SCOP 1.75: d2gcya1, d2gcya2
  • Chain 'B':
    Compound: huC25 fab fragment heavy chain
    Species: MUS MUSCULUS
    Gene: humanized mouse gene
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gcyA (A:)
    eivltqspatlslspgeratiscrasesvdsyghsfmqwyqqkpgqaprlliyrasnlep
    giparfsgsgsgtdftltisslepedfavyycqqsneapftfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    No sequence available.