PDB entry 2gcy

View 2gcy on RCSB PDB site
Description: humanized antibody C25 Fab fragment
Class: immune system
Keywords: antibody fragment mouse humanized, IMMUNE SYSTEM
Deposited on 2006-03-14, released 2007-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: huC25 fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Gene: humanized mouse gene
    Database cross-references and differences (RAF-indexed):
    • PDB 2GCY (0-215)
    Domains in SCOPe 2.08: d2gcya1, d2gcya2
  • Chain 'B':
    Compound: huC25 fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: humanized mouse gene
    Database cross-references and differences (RAF-indexed):
    • PDB 2GCY (0-217)
    Domains in SCOPe 2.08: d2gcyb1, d2gcyb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gcyA (A:)
    eivltqspatlslspgeratiscrasesvdsyghsfmqwyqqkpgqaprlliyrasnlep
    giparfsgsgsgtdftltisslepedfavyycqqsneapftfgqgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gcyB (B:)
    qvqlqesggglvqpggslrlscaasgftfsdyymywvrqapgkglewvatisdggsytyy
    pdsvkgrftisrdnskntlylqmnslraedtamyycsryryddamdywgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep