PDB entry 2gcx

View 2gcx on RCSB PDB site
Description: Solution Structure of Ferrous Iron Transport Protein A (FeoA) of Klebsiella pneumoniae
Class: transport protein
Keywords: Klebsiella pneumoniae, FeoA, Ferrous iron transport protein A, NMR
Deposited on 2006-03-14, released 2007-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrous iron transport protein A
    Species: Klebsiella pneumoniae [TaxId:573]
    Database cross-references and differences (RAF-indexed):
    • PDB 2GCX (0-74)
    Domains in SCOPe 2.07: d2gcxa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gcxA (A:)
mqftpdsawkitgfsrdispayrqkllslgmlpgssfhvvrvaplgdpvhietrrvslvl
rkkdlalieleavaq