PDB entry 2gcl

View 2gcl on RCSB PDB site
Description: Structure of the Pob3 Middle domain
Class: replication
Keywords: chromaint, double PH domain, yFACT, DNA replication, RPA
Deposited on 2006-03-14, released 2006-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.21
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04636
      • engineered (79-80)
      • engineered (82)
      • modified residue (201)
    Domains in SCOPe 2.07: d2gcla1
  • Chain 'B':
    Compound: Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04636
      • engineered (79-80)
      • engineered (82)
      • modified residue (201)
    Domains in SCOPe 2.07: d2gclb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gclA (A:)
    ghmaeafyeelkekadigevagdaivsfqdvffttprgrydidiyknsirlrgktyeykl
    qhrqiqrivslpkaddihhmmvmaiepplrqgqttypflvlqfqkdeetevqlnlededy
    eenykdklkkqydakthivlshvlkgltdrrvivpgeykskydqcavscsfkanegylyp
    ldnafffltkptlyipfsdvsmvnisragqtstssrtfdlevvlrsnrgsttfaniskee
    qqlleqflksknlrvknedre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gclA (A:)
    vagdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihh
    mmvmaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthiv
    lshvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsd
    vsmvnisrrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gclB (B:)
    ghmaeafyeelkekadigevagdaivsfqdvffttprgrydidiyknsirlrgktyeykl
    qhrqiqrivslpkaddihhmmvmaiepplrqgqttypflvlqfqkdeetevqlnlededy
    eenykdklkkqydakthivlshvlkgltdrrvivpgeykskydqcavscsfkanegylyp
    ldnafffltkptlyipfsdvsmvnisragqtstssrtfdlevvlrsnrgsttfaniskee
    qqlleqflksknlrvknedre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gclB (B:)
    agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhm
    mvmaiepplrqgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
    shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
    smvnisrartfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkne