PDB entry 2gcj

View 2gcj on RCSB PDB site
Description: Crystal Structure of the Pob3 middle domain
Class: replication
Keywords: Chromatin, FACT, double PH domain
Deposited on 2006-03-14, released 2006-05-23
The last revision prior to the SCOP 1.75 freeze date was dated 2006-05-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.219
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region
    Species: Saccharomyces cerevisiae
    Gene: Pob3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04636
      • engineered (90)
    Domains in SCOP 1.75: d2gcja1
  • Chain 'B':
    Compound: Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region
    Species: Saccharomyces cerevisiae
    Gene: Pob3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04636
      • engineered (90)
    Domains in SCOP 1.75: d2gcjb1
  • Chain 'C':
    Compound: Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region
    Species: Saccharomyces cerevisiae
    Gene: Pob3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04636
      • engineered (90)
    Domains in SCOP 1.75: d2gcjc1
  • Chain 'D':
    Compound: Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region
    Species: Saccharomyces cerevisiae
    Gene: Pob3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04636
      • engineered (90)
    Domains in SCOP 1.75: d2gcjd1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gcjA (A:)
    ghmaeafyeelkekadigevagdaivsfqdvffttprgrydidiyknsirlrgktyeykl
    qhrqiqrivslpkaddihhllvlaiepplrkgqttypflvlqfqkdeetevqlnlededy
    eenykdklkkqydakthivlshvlkgltdrrvivpgeykskydqcavscsfkanegylyp
    ldnafffltkptlyipfsdvsmvnisragqtstssrtfdlevvlrsnrgsttfaniskee
    qqlleqflksknlrvknedre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gcjA (A:)
    agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl
    lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
    shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
    smvnisrrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gcjB (B:)
    ghmaeafyeelkekadigevagdaivsfqdvffttprgrydidiyknsirlrgktyeykl
    qhrqiqrivslpkaddihhllvlaiepplrkgqttypflvlqfqkdeetevqlnlededy
    eenykdklkkqydakthivlshvlkgltdrrvivpgeykskydqcavscsfkanegylyp
    ldnafffltkptlyipfsdvsmvnisragqtstssrtfdlevvlrsnrgsttfaniskee
    qqlleqflksknlrvknedre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gcjB (B:)
    vagdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihh
    llvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthiv
    lshvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsd
    vsmvnisrrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gcjC (C:)
    ghmaeafyeelkekadigevagdaivsfqdvffttprgrydidiyknsirlrgktyeykl
    qhrqiqrivslpkaddihhllvlaiepplrkgqttypflvlqfqkdeetevqlnlededy
    eenykdklkkqydakthivlshvlkgltdrrvivpgeykskydqcavscsfkanegylyp
    ldnafffltkptlyipfsdvsmvnisragqtstssrtfdlevvlrsnrgsttfaniskee
    qqlleqflksknlrvknedre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gcjC (C:)
    evagdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddih
    hllvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthi
    vlshvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfs
    dvsmvnisrrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gcjD (D:)
    ghmaeafyeelkekadigevagdaivsfqdvffttprgrydidiyknsirlrgktyeykl
    qhrqiqrivslpkaddihhllvlaiepplrkgqttypflvlqfqkdeetevqlnlededy
    eenykdklkkqydakthivlshvlkgltdrrvivpgeykskydqcavscsfkanegylyp
    ldnafffltkptlyipfsdvsmvnisragqtstssrtfdlevvlrsnrgsttfaniskee
    qqlleqflksknlrvknedre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gcjD (D:)
    agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl
    lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
    shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
    smvnisrrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn