PDB entry 2gcd

View 2gcd on RCSB PDB site
Description: TAO2 kinase domain-staurosporine structure
Class: transferase
Keywords: TAO2, MAP3K, inhibitor, staurosporine, TRANSFERASE
Deposited on 2006-03-14, released 2006-09-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase TAO2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: tao2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLS3 (0-308)
      • modified residue (169)
    Domains in SCOPe 2.08: d2gcda_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase TAO2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: tao2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLS3 (0-308)
      • modified residue (169)
    Domains in SCOPe 2.08: d2gcdb_
  • Heterogens: STU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gcdA (A:)
    dpdvaelffkddpeklfsdlreighgsfgavyfardvrnsevvaikkmsysgkqsnekwq
    diikevrflqklrhpntiqyrgcylrehtawlvmeyclgsasdllevhkkplqeveiaav
    thgalqglaylhshnmihrdvkagnillsepglvklgdfgsasimapansfvgtpywmap
    evilamdegqydgkvdvwslgitcielaerkpplfnmnamsalyhiaqnespalqsghws
    eyfrnfvdsclqkipqdrptsevllkhrfvlrerpptvimdliqrtkdavreldnlqyrk
    mkkilfqea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gcdB (B:)
    dpdvaelffkddpeklfsdlreighgsfgavyfardvrnsevvaikkmsysgkqsnekwq
    diikevrflqklrhpntiqyrgcylrehtawlvmeyclgsasdllevhkkplqeveiaav
    thgalqglaylhshnmihrdvkagnillsepglvklgdfgsasimapansfvgtpywmap
    evilamdegqydgkvdvwslgitcielaerkpplfnmnamsalyhiaqnespalqsghws
    eyfrnfvdsclqkipqdrptsevllkhrfvlrerpptvimdliqrtkdavreldnlqyrk
    mkkilfqea