PDB entry 2gcc

View 2gcc on RCSB PDB site
Description: solution structure of the gcc-box binding domain, nmr, minimized mean structure
Deposited on 1998-03-13, released 1999-03-23
The last revision prior to the SCOP 1.61 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d2gcc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gcc_ (-)
    khyrgvrqrpwgkfaaeirdpakngarvwlgtfetaedaalaydraafrmrgsrallnfp
    lrv