PDB entry 2gcc

View 2gcc on RCSB PDB site
Description: solution structure of the gcc-box binding domain, nmr, minimized mean structure
Class: transcription factor
Keywords: transcription factor, ethlene inducible
Deposited on 1998-03-13, released 1999-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aterf1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ATERF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gcca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2gccA (A:)
akgkhyrgvrqrpwgkfaaeirdpakngarvwlgtfetaedaalaydraafrmrgsrall
nfplrvnsge

    Sequence, based on observed residues (ATOM records): (download) 
    >2gccA (A:)
khyrgvrqrpwgkfaaeirdpakngarvwlgtfetaedaalaydraafrmrgsrallnfp
lrv