PDB entry 2gca

View 2gca on RCSB PDB site
Description: apo form of L. casei FPGS
Class: ligase
Keywords: ATPase, P-loop enzyme, apo form, Ligase
Deposited on 2006-03-13, released 2006-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Folylpolyglutamate synthase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: fgs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gcaa1, d2gcaa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gcaA (A:)
    mnytetvayihsfprlaktgdhrriltllhalgnpqqqgryihvtgtngkgsaanaiahv
    leasgltvglytspfimrfnerimidhepipdaalvnavafvraalerlqqqqadfnvte
    fefitalgywyfrqrqvdvavievgiggdtdstnvitpvvsvltevaldhqkllghtita
    iakhkagiikrgipvvtgnlvpdaaavvaakvattgsqwlrfdrdfsvpkaklhgwgqrf
    tyedqdgrisdlevplvgdyqqrnmaiaiqtakvyakqtewpltpqnirqglaashwpar
    lekisdtplividgahnpdginglitalkqlfsqpitviagiladkdyaamadrltaafs
    tvylvpvpgtpralpeagyealhegrlkdswqealaaslndvpdqpivitgslylasavr
    qtllggks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gcaA (A:)
    mnytetvayihsfprlaktgdhrriltllhalgnpqqqgryihvtgtngkgsaanaiahv
    leasgltvglytspfimrfnerimidhepipdaalvnavafvraalerlqqqqadfnvte
    fefitalgywyfrqrqvdvavievgiggdtdstnvitpvvsvltevaldhqkllghtita
    iakhkagiikrgipvvtgnlvpdaaavvaakvattgsqwlrfdrdfsvpkaklhgwgqrf
    tyedqdgrisdlevplvgdyqqrnmaiaiqtakvyakqtewpltpqnirqglaashwpar
    lekisdtplividgahnpdginglitalkqlfsqpitviagilyaamadrltaafstvyl
    vpvpgtpralrlkdswqealaaslndvpdqpivitgslylasavrqtllg