PDB entry 2gc9

View 2gc9 on RCSB PDB site
Description: Crystal structure of p-coumaric acid decarboxylase (NP_786857.1) from Lactobacillus plantarum at 1.70 A resolution
Class: lyase
Keywords: NP_786857.1, P-COUMARIC ACID DECARBOXYLASE, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2006-03-13, released 2006-03-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-31, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.177
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-coumaric acid decarboxylase
    Species: Lactobacillus plantarum WCFS1
    Gene: pc05870a
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88RY7 (1-178)
      • modified residue (1)
      • modified residue (44)
      • modified residue (59)
      • modified residue (82)
      • modified residue (116)
      • modified residue (140)
      • modified residue (159)
    Domains in SCOP 1.73: d2gc9a1
  • Chain 'B':
    Compound: p-coumaric acid decarboxylase
    Species: Lactobacillus plantarum WCFS1
    Gene: pc05870a
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88RY7 (1-End)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (44)
      • modified residue (59)
      • modified residue (82)
      • modified residue (116)
      • modified residue (140)
      • modified residue (159)
  • Heterogens: SO4, CIT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gc9A (A:)
    gmtktfktlddflgthfiytydngweyewyakndhtvdyrihggmvagrwvtdqkadivm
    ltegiykiswteptgtdvaldfmpnekklhgtiffpkwveehpeitvtyqnehidlmeqs
    rekyatypklvvpefanitymgdagqnnedviseapykempndirngkyfdqnyhrlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gc9A (A:)
    mtktfktlddflgthfiytydngweyewyakndhtvdyrihggmvagrwvtdqkadivml
    tegiykiswteptgtdvaldfmpnekklhgtiffpkwveehpeitvtyqnehidlmeqsr
    ekyatypklvvpefanitymgdagqnnedviseapykempndirngkyfdqnyhrlnk
    

  • Chain 'B':
    No sequence available.