PDB entry 2gc7

View 2gc7 on RCSB PDB site
Description: Substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from Paracoccus denitrificans.
Class: Oxidoreductase, Electron transport
Keywords: Electron transfer, Methylamine dehydrogenase, Cytochrome, amicyanin
Deposited on 2006-03-13, released 2007-02-06
The last revision prior to the SCOP 1.73 freeze date was dated 2007-02-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.171
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00629882 (Start-385)
    Domains in SCOP 1.73: d2gc7a1
  • Chain 'B':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22619 (Start-130)
      • modified residue (56)
    Domains in SCOP 1.73: d2gc7b1
  • Chain 'C':
    Compound: amicyanin
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gc7c1
  • Chain 'D':
    Compound: cytochrome c-l
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gc7d1
  • Chain 'E':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00629882 (Start-385)
    Domains in SCOP 1.73: d2gc7e1
  • Chain 'F':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22619 (Start-130)
      • modified residue (56)
    Domains in SCOP 1.73: d2gc7f1
  • Chain 'G':
    Compound: amicyanin
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gc7g1
  • Chain 'H':
    Compound: cytochrome c-l
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gc7h1
  • Chain 'I':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00629882 (Start-385)
    Domains in SCOP 1.73: d2gc7i1
  • Chain 'J':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22619 (Start-130)
      • modified residue (56)
    Domains in SCOP 1.73: d2gc7j1
  • Chain 'K':
    Compound: amicyanin
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gc7k1
  • Chain 'L':
    Compound: cytochrome c-l
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gc7l1
  • Chain 'M':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00629882 (Start-385)
    Domains in SCOP 1.73: d2gc7m1
  • Chain 'N':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22619 (Start-130)
      • modified residue (56)
    Domains in SCOP 1.73: d2gc7n1
  • Chain 'O':
    Compound: amicyanin
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gc7o1
  • Chain 'P':
    Compound: cytochrome c-l
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gc7p1
  • Heterogens: NA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gc7A (A:)
    qdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtq
    qfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtll
    ptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpd
    cyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrl
    vwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdq
    rdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihd
    aesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gc7A (A:)
    eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvi
    dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
    ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
    fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
    ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
    rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
    eelrsvnqlghgpqvittadmg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gc7B (B:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gc7B (B:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gc7C (C:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gc7D (D:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gc7E (E:)
    qdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtq
    qfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtll
    ptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpd
    cyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrl
    vwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdq
    rdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihd
    aesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gc7E (E:)
    eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvi
    dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
    ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
    fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
    ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
    rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
    eelrsvnqlghgpqvittadmg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gc7F (F:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gc7F (F:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gc7G (G:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gc7H (H:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2gc7I (I:)
    qdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtq
    qfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtll
    ptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpd
    cyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrl
    vwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdq
    rdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihd
    aesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gc7I (I:)
    eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvi
    dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
    ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
    fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
    ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
    rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
    eelrsvnqlghgpqvittadmg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2gc7J (J:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gc7J (J:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gc7K (K:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gc7L (L:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqp
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2gc7M (M:)
    qdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtq
    qfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtll
    ptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpd
    cyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrl
    vwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdq
    rdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihd
    aesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gc7M (M:)
    eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvi
    dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
    ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
    fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
    ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
    rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
    eelrsvnqlghgpqvittadmg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2gc7N (N:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gc7N (N:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gc7O (O:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gc7P (P:)
    apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
    hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
    rhlytgdpkdaswltdeqkagftpfqp