PDB entry 2gc6

View 2gc6 on RCSB PDB site
Description: S73A mutant of L. casei FPGS
Class: Ligase
Keywords: ATPase, P-loop, site-directed mutant, Ligase
Deposited on 2006-03-13, released 2006-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Folylpolyglutamate synthase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: fgs
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15925 (0-End)
      • engineered (72)
    Domains in SCOPe 2.08: d2gc6a1, d2gc6a2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gc6A (A:)
    mnytetvayihsfprlaktgdhrriltllhalgnpqqqgryihvtgtngkgsaanaiahv
    leasgltvglytapfimrfnerimidhepipdaalvnavafvraalerlqqqqadfnvte
    fefitalgywyfrqrqvdvavievgiggdtdstnvitpvvsvltevaldhqkllghtita
    iakhkagiikrgipvvtgnlvpdaaavvaakvattgsqwlrfdrdfsvpkaklhgwgqrf
    tyedqdgrisdlevplvgdyqqrnmaiaiqtakvyakqtewpltpqnirqglaashwpar
    lekisdtplividgahnpdginglitalkqlfsqpitviagiladkdyaamadrltaafs
    tvylvpvpgtpralpeagyealhegrlkdswqealaaslndvpdqpivitgslylasavr
    qtllggks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gc6A (A:)
    mnytetvayihsfprladhrriltllhalgnpqqqgryihvtgtngkgsaanaiahvlea
    sgltvglytapfimrfnerimidhepipdaalvnavafvraalerlqqqqadfnvtefef
    italgywyfrqrqvdvavievgiggdtdstnvitpvvsvltevaldhqkllghtitaiak
    hkagiikrgipvvtgnlvpdaaavvaakvattgsqwlrfdrdfsvpkaklhgwgqrftye
    dqdgrisdlevplvgdyqqrnmaiaiqtakvyakqtewpltpqnirqglaashwparlek
    isdtplividgahnpdginglitalkqlfsqpitviagilyaamadrltaafstvylvpv
    pgtpralrlkdswqealaaslndvpdqpivitgslylasavrqtllg